PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.6G214900.1.p
Common NameSETIT_015521mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family LBD
Protein Properties Length: 193aa    MW: 20877.6 Da    PI: 6.5043
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.6G214900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260121.35.3e-38201201101
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+Ca+dCvlapyfpa+qp+++a vh +FG+sn ++ll++lp +er +a+++++ eA++r++dPvyG++gvi +lqq+++ ++
  Seita.6G214900.1.p  20 RCAACKYLRRRCAPDCVLAPYFPASQPRRYADVHAVFGTSNATRLLQSLPVQERGRAADTMAAEARWRVQDPVYGCTGVIDRLQQEIRAVQ 110
                         6****************************************************************************************** PP

              DUF260  92 aelallkeel 101
                         +ela+++++l
  Seita.6G214900.1.p 111 HELATTRAQL 120
                         *****99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.83919120IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-3720117IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MEVVDQQQLD YGGGSNNPRR CAACKYLRRR CAPDCVLAPY FPASQPRRYA DVHAVFGTSN  60
ATRLLQSLPV QERGRAADTM AAEARWRVQD PVYGCTGVID RLQQEIRAVQ HELATTRAQL  120
AVHAHRGAPP PPQATPQLMS LPPPPHQPLA AAAAAAVAVH AGARGAVAVR EADEEEEPLM  180
DPDEFLDLDG RF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004974860.22e-93PREDICTED: LOB domain-containing protein 24-like
SwissprotP594675e-40LBD23_ARATH; LOB domain-containing protein 23
SwissprotP594684e-40LBD24_ARATH; LOB domain-containing protein 24
TrEMBLK3YMP01e-137K3YMP0_SETIT; Uncharacterized protein
STRINGSi015521m1e-137(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52823562
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.16e-41LOB domain-containing protein 24